PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr10P06580_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family MIKC_MADS
Protein Properties Length: 202aa    MW: 23158 Da    PI: 9.9067
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr10P06580_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF91.73.5e-291059251
                            ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
                  SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                            rien   rqvtfskRrng+lKKA+ELSvLCdaeva+i+fss+gkl e++s
  GSMUA_Achr10P06580_001 10 RIENAASRQVTFSKRRNGLLKKAYELSVLCDAEVALIVFSSRGKLWEFCS 59
                            8***********************************************96 PP

2K-box67.44.8e-2381173799
                   K-box   7 ksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenka 93 
                              s+ +++++ l  e++++ k+ie ++  +R+llGe Le++s  eL++L +qLe+sl++iR++K+ ll eqi el++kek+l +enk 
  GSMUA_Achr10P06580_001  81 HSAMTQEMKDLMSEATNMTKKIELIEAHKRKLLGETLETCSAAELHELGNQLEESLRQIRKRKQCLLAEQIAELREKEKSLLKENKL 167
                             346778899999*************************************************************************** PP

                   K-box  94 Lrkkle 99 
                             L++k++
  GSMUA_Achr10P06580_001 168 LHEKFK 173
                             ***986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006631.3161IPR002100Transcription factor, MADS-box
SMARTSM004328.1E-39160IPR002100Transcription factor, MADS-box
CDDcd002653.29E-38371No hitNo description
PRINTSPR004041.1E-30323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
SuperFamilySSF554556.15E-31375IPR002100Transcription factor, MADS-box
PfamPF003191.0E-251057IPR002100Transcription factor, MADS-box
PRINTSPR004041.1E-302338IPR002100Transcription factor, MADS-box
PRINTSPR004041.1E-303859IPR002100Transcription factor, MADS-box
PfamPF014862.4E-2387172IPR002487Transcription factor, K-box
PROSITE profilePS5129712.80988178IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 202 aa     Download sequence    Send to blast
MVRGKTEVRR IENAASRQVT FSKRRNGLLK KAYELSVLCD AEVALIVFSS RGKLWEFCSS  60
SSIEKTMDRY LMQTKDVNTK HSAMTQEMKD LMSEATNMTK KIELIEAHKR KLLGETLETC  120
SAAELHELGN QLEESLRQIR KRKQCLLAEQ IAELREKEKS LLKENKLLHE KFKGGNMLRL  180
NAAEVQSMEV NTQLMIGRPA TL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3kov_A9e-20385279Myocyte-specific enhancer factor 2A
3kov_B9e-20385279Myocyte-specific enhancer factor 2A
3kov_I9e-20385279Myocyte-specific enhancer factor 2A
3kov_J9e-20385279Myocyte-specific enhancer factor 2A
3p57_A9e-20385279Myocyte-specific enhancer factor 2A
3p57_B9e-20385279Myocyte-specific enhancer factor 2A
3p57_C9e-20385279Myocyte-specific enhancer factor 2A
3p57_D9e-20385279Myocyte-specific enhancer factor 2A
3p57_I9e-20385279Myocyte-specific enhancer factor 2A
3p57_J9e-20385279Myocyte-specific enhancer factor 2A
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY1983293e-39AY198329.1 Lolium perenne MADS4 mRNA, complete cds.
GenBankAY5410673e-39AY541067.1 Hordeum vulgare subsp. vulgare AGAMOUS LIKE6-like protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009420441.11e-145PREDICTED: agamous-like MADS-box protein AGL19 isoform X2
SwissprotO646455e-63SOC1_ARATH; MADS-box protein SOC1
SwissprotQ9XJ607e-63MAD50_ORYSJ; MADS-box transcription factor 50
TrEMBLM0RFY51e-145M0RFY5_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr10P06580_0011e-145(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP14133379
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45660.12e-57AGAMOUS-like 20